Application
Rabbit Anti-MXD3 antibody is suitable for western blot applications at a concentration of 1 µg/ml.
Biochem/physiol Actions
MXD3 contains 1 basic helix-loop-helix (bHLH) domain. It is a transcriptional repressor and binds with MAX to form a sequence-specific DNA-binding protein complex which recognizes the core sequence 5′-CAC[GA]TG-3′. Antagonizes MYC transcriptional activity by competing for MAX and suppresses MYC dependent cell transformation.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
MXD3 is a basic, helix-loop-helix transcription factor that belongs to the MAD family of proteins. This protein is involved in cerebellar development and GNP proliferation. Studies have reported that MXD3 is also required for the proliferation of DAOY medulloblastoma cells.Rabbit Anti-MXD3 antibody binds to chicken, human, mouse, rat, bovine, zebrafish, and canine MXD3.
Immunogen
Synthetic peptide directed towards the N terminal region of human MXD3
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MEPLASNIQVLLQAAEFLERREREAEHGYASLCPHRSPGPIHRRKKRPPQ
This product has met the following criteria: