Application

Rabbit Anti-HSPBAP1 antibody is suitable for western blot applications at a concentration of 0.25 µg/ml and for immunohistochemistry applications at a concentration of 4-8 µg/ml.

Biochem/physiol Actions

HSPBAP1 may play a role in cellular stress response.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

HSPBAP1 codes for a protein that binds to and inhibits the functions of the heat shock protein, hsp27. HSPBAP1 expression has been implicated in intractable epilepsy. DIRC3-HSPBAP1 fusion transcripts have been associated with familial renal cell carcinogenesis.Rabbit Anti-HSPBAP1 antibody recognizes human HSPBAP1.

Immunogen

Synthetic peptide directed towards the C terminal region of human HSPBAP1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SDGKDFVDKDGEHFGKLHCAKRQQIMSNSENAIEEQIASNTTTTPQTFIS