Application
Rabbit Anti-HSPBAP1 antibody is suitable for western blot applications at a concentration of 0.25 µg/ml and for immunohistochemistry applications at a concentration of 4-8 µg/ml.
Biochem/physiol Actions
HSPBAP1 may play a role in cellular stress response.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
HSPBAP1 codes for a protein that binds to and inhibits the functions of the heat shock protein, hsp27. HSPBAP1 expression has been implicated in intractable epilepsy. DIRC3-HSPBAP1 fusion transcripts have been associated with familial renal cell carcinogenesis.Rabbit Anti-HSPBAP1 antibody recognizes human HSPBAP1.
Immunogen
Synthetic peptide directed towards the C terminal region of human HSPBAP1
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SDGKDFVDKDGEHFGKLHCAKRQQIMSNSENAIEEQIASNTTTTPQTFIS
This product has met the following criteria: