Application

Rabbit Anti-ZNF71 antibody is suitable for western blot applications at a concentration of 1.0 µg/ml.

Biochem/physiol Actions

ZNF71 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

ZNF71 is a zing finger protein that may be involved in transcriptional regulation.Rabbit Anti-ZNF71 antibody recognizes human ZNF71.

Immunogen

Synthetic peptide directed towards the N terminal region of human ZNF71

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MKELDPKNDISEDKLSVVGEATGGPTRNGARGPGSEGVWEPGSWPERPRG