Application
Rabbit Anti-DEAF1 is suitable for western blot applications at a concentration of 0.5 µg/ml.
Biochem/physiol Actions
DEAF1 down-regulates transcription of those genes by binding to sequence with multiple copies of TTC[CG]G present in their own promoter and that of the HNRPA2B1 gene. DEAF1 binds to the retinoic acid response element (RARE) AGGGTTCACCGAAAGTTCA. DEAF1 activates the proenkephalin gene independently of promoter binding, probably through protein-protein interaction. When secreted, behaves as an inhibitor of cell proliferation, by arresting cells in the G0 or G1 phase.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
DEAF1 is a transcription factor that regulates innate immune responses in Drosophila. It also modulates the expression of tissue antigens in pancreatic lymph nodes of type 1 diabetic mice. DEAF1 mutations have been linked to intellectual deformities, behavioral disorders and speech impairment.Rabbit Anti-DEAF1 antibody recognizes human, mouse, rat, chicken, and canine DEAF1.
Immunogen
Synthetic peptide directed towards the C terminal region of human DEAF1
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TGCHKVNYCSTFCQRKDWKDHQHICGQSAAVTVQADEVHVAESVMEKVTV
This product has met the following criteria: