Application

Rabbit Anti-ZNF307 antibody is suitable for western blot applications at a concentration of 1.25 µg/ml.

Biochem/physiol Actions

ZNF307 contains 1 SCAN box domain, 1 KRAB domain and 7 C2H2-type zinc fingers. It belongs to the Krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

ZNF307 (ZKSCAN4) is a zinc finger protein that has SCAN and KRAB domains. This protein is known to interact with glucocorticoid receptor.Rabbit Anti- ZNF307 antibody recognizes bovine, human, mouse, and rat ZNF307.

Immunogen

Synthetic peptide directed towards the C terminal region of human ZNF307

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: FTRNRSLIEHQKIHTGEKPYQCDTCGKGFTRTSYLVQHQRSHVGKKTLSQ