Application
Rabbit Anti-ZFP64 antibody is suitable for western blotting applications at a concentration of 2.5 µg/ml.
Biochem/physiol Actions
ZFP64 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 9 C2H2-type zinc fingers and may be involved in transcriptional regulation.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
ZFP64 is a zinc-finger protein that enhances p65 stimulation and thereby promotes TLR-induced production of pro-inflammatory cytokines and type I interferons in macrophages.Rabbit Anti-ZFP64 antibody recognizes bovine, canine, human, and pig ZFP64.
Immunogen
Synthetic peptide directed towards the N terminal region of human ZFP64
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MNASSEGESFAGSVQIPGGTTVLVELTPDIHICGICKQQFNNLDAFVAHK
This product has met the following criteria: