Application

Anti-HOXC10 (AB2) polyclonal antibody is used to tag the Homeobox C10 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of Homeobox C10 in body pattern development during embryogenesis. Detection of HOXC10 may also be use to help differentiate stem cell populations and cancer cells.

Biochem/physiol Actions

HOXC10 belongs to the homeobox family. The homeobox family is a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. The protein level is controlled during cell differentiation and proliferation, which may indicate this protein has a role in origin activation.This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The protein level is controlled during cell differentiation and proliferation, which may indicate this protein has a role in origin activation.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

HOX proteins are transcription factors involve in spatial and temporal order critical to body patterning (axial patterning) and limb development during embryonic development. HOXC10, an orthologues of the Abdominal-B gene of Drosophila, is a homeoprotein that is critical for development of the spinal cord and formation of neurons. HOXC10 is a good candidate maker for discrimination of mesenchymal stem cells (MSC) from unrestricted somatic stem cells (USSC). HOXC10 is overexpressed in breast cancer.

Immunogen

Synthetic peptide directed towards the N terminal region of human HOXC10

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MTCPRNVTPNSYAEPLAAPGGGERYSRSAGMYMQSGSDFNCGVMRGCGLA

Specificity

Anti-HOXC10 (AB2) polyclonal antibody reacts with canine, rat, mouse, and human Homeobox C10 proteins.