AV39074-100UL Display Image

Anti-CBX6

Code: AV39074-100UL D2-231

Biochem/physiol Actions

CBX6 (chromobox homolog 6) is a transcription repressor belonging to the polycomb CBX family. CBX family members are associated with chromatin in diff...


read more

Your Price
£377.00 100UL
£452.40 inc. VAT

Biochem/physiol Actions

CBX6 (chromobox homolog 6) is a transcription repressor belonging to the polycomb CBX family. CBX family members are associated with chromatin in different subnuclear regions and control the development in embryonic stem cells and fibroblasts.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of human CBX6

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SAATSKRAPPEVTAAAGPAPPTAPEPAGASSEPEAGDWRPEMSPCSNVVV

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... CBX6(23466)
mol wt44 kDa
NCBI accession no.NP_055107
Quality Level100
shipped inwet ice
species reactivityhorse, guinea pig, bovine, rat, mouse, dog, human
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.O95503
This product has met the following criteria: