AV39004-100UL Display Image

Anti-IKZF3

Code: AV39004-100UL D2-231

Biochem/physiol Actions

IKZF3 is a member of Ikaros family of hematopoietic-specific transcription factor involved in the proliferation and differentiation of lymphocytes. IK...


read more

Your Price
£459.00 100UL
Discontinued
£550.80 inc. VAT

Biochem/physiol Actions

IKZF3 is a member of Ikaros family of hematopoietic-specific transcription factor involved in the proliferation and differentiation of lymphocytes. IKZF3 forms homodimers and heterodimers with another Ikaros family member to regulate chromatin remodeling and gene expression in B lymphocytes.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human IKZF3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: KSTQEQSVPAESAAVLNDYSLTKSHEMENVDSGEGPANEDEDIGDDSMKV

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... IKZF3(22806)
mol wt52 kDa
NCBI accession no.NP_036613
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q9UKT9-2
This product has met the following criteria: