Biochem/physiol Actions
IKZF3 is a member of Ikaros family of hematopoietic-specific transcription factor involved in the proliferation and differentiation of lymphocytes. IKZF3 forms homodimers and heterodimers with another Ikaros family member to regulate chromatin remodeling and gene expression in B lymphocytes.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the N terminal region of human IKZF3
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KSTQEQSVPAESAAVLNDYSLTKSHEMENVDSGEGPANEDEDIGDDSMKV
This product has met the following criteria: