SAB2107969-100UL Display Image

ANTI-ZFP64

Code: SAB2107969-100UL D2-231

Biochem/physiol Actions

ZFP64 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 9 C2H2-type zinc fingers and may be involved in transcriptional regula...


read more

Your Price
£362.00 100UL
Discontinued
£434.40 inc. VAT

Biochem/physiol Actions

ZFP64 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 9 C2H2-type zinc fingers and may be involved in transcriptional regulation.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of human ZFP64

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SDGGQNIAVATTAPPVFSSSSQQELPKQTYSIIQGAAHPALLCPADSIPD

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ZFP64(55734)
mol wt69kDa
NCBI accession no.NM_022088
Quality Level100
shipped inwet ice
species reactivitypig, human, bovine, dog
storage temp.−20°C
technique(s)immunoblotting: suitable
UniProt accession no.Q9NPA5-2
This product has met the following criteria: