Biochem/physiol Actions

The E2 enzyme encoded by the gene UBE2O (ubiquitin conjugating enzyme E2 O) negatively regulates TRAF6-mediated IL-1R (interleukin-1R)/TLR4 (toll-like receptor4) signaling via the inhibition of polyubiquitination of TRAF6 (tumor necrosis factors receptor associated factor 6). It hinders the formation of MyD88-TRAF6 protein complex. It prevents TRAF6-dependent NF-κB (nuclear factor-κB) signaling. It is involved in the ubiquitination of the nuclear localization signal of BAP1 (BRCA1 associated protein 1), a tumor suppressor that regulates cell proliferation. UBE2O interacts and monoubiquitinates SMAD6, an inhibitory regulator of bone morphogenetic protein (BMP)/SMAD signaling, thereby regulating BMP7 (bone morphogenetic protein)-induced adipogenesis.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

The gene UBE2O (ubiquitin conjugating enzyme E2 O) encodes a member of the E2 family of ubiquitin-conjugating enzymes. The encoded protein is large with a molar mass of 140kDa. It contains a ubiquitin-conjugating (UBC) domain and is expressed ubiquitously, with increased expression in brain, skeletal muscle, and heart tissues. It is found to be up-regulated during the reticulocyte stage of erythroid differentiation.

Immunogen

Synthetic peptide directed towards the middle region of human UBE2O

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: YNEAGFDSDRGLQEGYENSRCYNEMALIRVVQSMTQLVRRPPEVFEQEIR