Application
Rabbit Anti-TFB2M (AB1) antibody is suitable for western blot (1.25 µg/ml) and IHC (4-8 µg/ml) applications.
Biochem/physiol Actions
TFB2M is a S-adenosyl-L-methionine-dependent methyltransferase which specifically dimethylates mitochondrial 12S rRNA at the conserved stem loop. It is also required for basal transcription of mitochondrial DNA, probably via its interaction with POLRMT and TFAM. It stimulates transcription independently of the methyltransferase activity. Compared to TFB1M, it activates transcription of mitochondrial DNA more efficiently, while it has less methyltransferase activity.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
TFB2M is a mitochondrial transcription factor that regulates the expression of SERCA2 gene in rat cardiomyocytes. It is also known to induce the transcription of human mtDNA.Rabbit Anti-TFB2M (AB1) antibody recognizes human and rat TFB2M.
Immunogen
Synthetic peptide directed towards the N terminal region of human TFB2M
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ECNPGPGILTQALLEAGAKVVALESDKTFIPHLESLGKNLDGKLRVIHCD
This product has met the following criteria: