Application

Anti-TFAP2E polyclonal antibody is used to tag transcription factor AP-2 epsilon for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of transcription factor AP-2 epsilon in skin development and colorectal cancer chemoresistance.

Biochem/physiol Actions

TFAP2E belongs to AP-2 family of transcription factors which play an important role in regulating gene expression during development and differentiation of multiple organs and tissues. It may play an important role in skin biology.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

The AP2 family of transcription factors is expressed during mammalian development, morphogenesis and in various malignancies. Transcription factor AP-2 epsilon (activating enhancer binding protein 2 epsilon) (TFAP2E, AP2epsilon) is expressed in skin and keratinocytes and melanocytes implicating it as a regulator of skin biology function such as melanophore differentiation. TFAP2E epigenetic modification has been implicated in colorectal cancer chemoresistance.

Immunogen

Synthetic peptide directed towards the C terminal region of human TFAP2E

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: FGGPAICAALTAFQNYLLESLKGLDKMFLSSVGSGHGETKASEKDAKHRK

Specificity

Anti-TFAP2E polyclonal antibody reacts with mouse, rat, human, and bovine transcription factor AP-2 epsilon proteins.