Application

Rabbit Anti-SUZ12 is suitable for western blot applications at a concentration of 1 µg/ml.

Biochem/physiol Actions

A chromosomal aberration involving SUZ12 may be a cause of endometrial stromal tumors. Translocation t (7;17)(p15;q21) with JAZF1 generates the JAZF1-SUZ12 oncogene consisting of the N-terminus part of JAZF1 and the C-terminus part of SUZ12. It is frequently found in all cases of endometrial stromal tumors, except in endometrial stromal sarcomas, where it is rarer.This zinc finger gene has been identified at the breakpoints of a recurrent chromosomal translocation reported in endometrial stromal sarcoma. Recombination of these breakpoints results in the fusion of this gene and JAZF1. The protein encoded by this gene contains a zinc finger domain in the C terminus of the coding region. The specific function of this gene has not yet been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

SUZ12 is a zinc-finger protein that is needed for the silencing and histone methyltransferase functions of the EED-EZH2 complex. SUZ12 is also known to be associated with all-trans retinoic acid response elements (RAREs).Rabbit Anti-SUZ12 antibody recognizes human, mouse, and bovine SUZ12.

Immunogen

Synthetic peptide directed towards the C terminal region of human SUZ12

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: ESASPANEEITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL