Biochem/physiol Actions

NR2E3 is a member of nuclear receptor transcription factor family involved in embryonic development. It is a ligand-dependent retinal nuclear receptor and regulates the number of S-cones in the retina. Mutations in gene encoding NR2E3 cause S-cone syndrome and disrupt human cone photoreceptor mosaic.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human NR2E3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: METRPTALMSSTVAAAAPAAGAASRKESPGRWGLGEDPTGVSPSLQCRVC