AV40674-100UL Display Image

Anti-POP4

Code: AV40674-100UL D2-231

Biochem/physiol Actions

POP4 is a part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5′-ends. It may function with RPP38 t...


read more

Your Price
£377.00 100UL

Biochem/physiol Actions

POP4 is a part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5′-ends. It may function with RPP38 to coordinate the nucleolar targeting and/or assembly of RNase P.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of human POP4

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: EDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAKGTIDL

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... POP4(10775)
mol wt24 kDa
NCBI accession no.NP_006618
Quality Level100
shipped inwet ice
species reactivityrat, bovine, human, horse, rabbit, dog, guinea pig
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.O95707
This product has met the following criteria: