Application

Anti-NOLC1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25µg/ml and for immunohistochemistry at a concentration of 4-8µg/ml.

Biochem/physiol Actions

NOLC1 encodes for a phosphoprotein, nucleolar and coiled-body phosphoprotein 1 that plays a crucial role in the synthesis of rRNA and the biosynthesis of ribosomes. It also induces tumorigenesis of nasopharyngeal carcinoma (NPC) and works cooperatively with tumor protein 53 for stimulating the MDM2 promoter in NPC cells.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of human NOLC1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ